PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011100829.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 353aa    MW: 39779.1 Da    PI: 5.525
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011100829.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF31.91.8e-101150342
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    i+++  r   f +R++g+ K A ELS+LC++++ +i++ +
  XP_011100829.1 11 ISSEKARVAAFERRKKGLEKAADELSTLCGVDIGMIVYLP 50
                    899999******************************9955 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.535148IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-5162IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.49E-13398IPR002100Transcription factor, MADS-box
PfamPF003197.5E-131151IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MVRAKLRLEL ISSEKARVAA FERRKKGLEK AADELSTLCG VDIGMIVYLP AQNNEANEPT  60
IWPKNGHELL ASLTHSYESR SGCDCRSRTY NLSAFFKDQT ERTEEELNKL RKKMREAKYP  120
KWDGRYNCLS GDQLKEIVSL LTTKIDAVRG RINSVKSSVI IYTESGASMD PSVQEYAVFN  180
PSMWTDIMEL QQPLAYYDAQ AIIPYQRRMM MMNNSASCSQ NTFSFGLNPA SAVSLPSMWT  240
DIMQQQQPLA YYDAQANIAD QRRMMMMNNG ASCSQNTFGF DENPDYYAYS CDEISAQNCG  300
LGRGIMENVG ANNCEPLMSY NMPNMAPIPQ NRQRPLLSGA FPQMQAAQGA DYV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100829.10.0PREDICTED: agamous-like MADS-box protein AGL92
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24572253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.11e-18AGAMOUS-like 82